Peptides
$75.00
Build a stack of 5+ compounds for 20% off — your protocol totals live in the bench tray, with the research-use-only acknowledgment captured at checkout.
For laboratory research use only · Not for human consumption
LL-37 is the 37-residue C-terminal peptide of the human cathelicidin antimicrobial protein hCAP-18.
Sequence
[LL-37, 37 aa]
Authoritative references
Every batch is independently third-party tested for identity, mass, and purity, and ships with a lot code you can verify. How we test →
Reconstitution Calculator
2.50mg/mL
2,500 mcg/mL
10.0units
on a U-100 syringe
Measurement math for laboratory research only. Not dosing guidance, medical advice, or a therapeutic claim.
Ratings reflect product quality — purity, labeling, packaging, reconstitution, and shipping. Research use only.
No reviews yet. Be the first to rate this product.
Sign in to leave a product-quality review.
Reference data is provided for laboratory identification only. Values are sourced from public chemistry databases; confirm against the batch COA. Not for human or animal use.
Complete the stack
Compounds researchers commonly explore alongside LL-37 (Cathelicidin). Build a stack of 5+ distinct compounds and 20% comes off the whole protocol (supplies excluded).
Pairings reflect compounds commonly researched together — not a protocol, combination guidance, or any therapeutic claim. Research use only.